Recombinant Human ETS1 Protein, His-tagged

Inquiry

  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0811
Product Overview:  Recombinant Human ETS1, transcript variant 2, fused with His tag at N-terminal was expressed in E. coli.
Description:  This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  33kD
Purity:  >95% as determined by SDS-PAGE and Coomassie blue staining
Species:  Human
Formulation:  Lyophilized from a 0.2 µM filtered solution of PBS, 1mM EDTA, pH 7.4
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDN
Endotoxin:  Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  ETS1 v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) [ Homo sapiens ]
Gene ID NCBI:  2113
Official Symbol:  ETS1
Synonyms:  ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768; p54; v-ets avian erythroblastosis virus E2 oncogene homolog 1; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; ETS-1; EWSR2;
mRNA Refseq:  NM_001143820
Protein Refseq:  NP_001137292
MIM:  164720
UniProt ID:  P14921
Product Types
◆ Extracts & Lysates
EL-0105 Recombinant Human ETS1 293 Cell Lysate Inquiry
◆ Antibodies
EAb-0139 ETO Polyclonal Antibody Inquiry
EAb-0195 ERM/ ETV5 Polyclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-0804 Recombinant Human ETS1 Inquiry
PE-0805 Recombinant Human ETS1 Inquiry
Related Gene / Proteins
ETO ETR3 ETS1 ETV5

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.