| Cat.No.: | EAb-3495 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 726-1009 of human HLTF |
| Immunogen Sequence: | VSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVPVITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 114kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | U-251MG,293T,LO2,A-549,HeLa,HT-1080 |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q14527; NP_620636.1; Gene ID 6596 |
| Alternative Name: | HLTF; HIP116; HIP116A; HLTF1; RNF80; SMARCA3; SNF2L3; ZBU1; helicase-like transcription factor |
| Scientific Background: | This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0420 | Human HLTF Knockout Cell Line 2bp deletion | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2507 | Recombinant Human HLF protein | Inquiry |
| PE-2815 | Recombinant Human HLF protein | Inquiry |
| ◆ Antibodies | ||
| EAb-3495 | HLTF Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HLF | HLTF | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.