| Cat.No.: | PE-2644 |
| Background: | Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites (By similarity). Seems to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters. |
| Applications: | Western blot; SDS-PAGE; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione |
| Accession#: | Q8NI51 |
| Alternative Names: | BORIS like protein/Brother of the regulator of imprinted sites/Cancer/testis antigen 27 |
| Tag: | GST |
| Amino Acid Sequence: | AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAK STKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLK T |
| Sequence Similarities: | Belongs to the CTCF zinc-finger protein family.Contains 11 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 193 to 293 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0168 | Human CTDSP1 Knockout Cell Line 26bp deletion | Inquiry |
| CL-0195 | Human CTDSPL Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0169 | Recombinant Human CTSL1 Cell Lysate | Inquiry |
| EL-0204 | Recombinant Human CTCFL 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0849 | CTCF Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| CTBP | CTBP2 | CTCF | CTCFL |
| CTDSP1 | CTDSPL | CtIP | ctnnb1 |
| CTSL1 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.