| Cat.No.: | PE-1548 |
| Product Name: | Recombinant Human HIC1 |
| Product Overview: | Recombinant fragment corresponding to amino acids 627-705 of Human HIC1 with N terminal proprietary tag; Predicted MWt 34.32 kDa. |
| Description: | This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. |
| Tissue Specificity: | Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 34.320kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
| Sequence Similarities: | Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.Contains 1 BTB (POZ) domain.Contains 5 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | 79 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | HIC1 hypermethylated in cancer 1 [ Homo sapiens ] |
| Gene ID NCBI: | 3090 |
| Official Symbol: | HIC1 |
| Synonyms: | HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901; |
| mRNA Refseq: | NM_001098202 |
| Protein Refseq: | NP_001091672 |
| MIM: | 603825 |
| UniProt ID: | Q14526 |
| Chromosome Location: | 17p13.3 |
| Function: | DNA binding; histone deacetylase binding; metal ion binding; protein binding; sequence-specific DNA binding; |
| Product Types | ||
| ◆ Nucleosomes | ||
| NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
| NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
| SP-0010 | Histone H4 peptide (1-21) | Inquiry |
| SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
| Related Gene / Proteins | |||
| HIC1 | HIF1A | HIF1AN | HINFP |
| HIPK1 | HIPK2 | HIRA | Histone |
| Histone H1 | Histone H2A | Histone H2B | Histone H3 |
| Histone H4 | HIV-1 reverse transcriptase | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
