Recombinant Human HIC1


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1548
Product Name:  Recombinant Human HIC1
Product Overview:  Recombinant fragment corresponding to amino acids 627-705 of Human HIC1 with N terminal proprietary tag; Predicted MWt 34.32 kDa.
Description:  This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants.
Tissue Specificity:  Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  34.320kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Sequence Similarities:  Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.Contains 1 BTB (POZ) domain.Contains 5 C2H2-type zinc fingers.
Expression System:  Wheat germ
Protein Length:  79 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  HIC1 hypermethylated in cancer 1 [ Homo sapiens ]
Gene ID NCBI:  3090
Official Symbol:  HIC1
Synonyms:  HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901;
mRNA Refseq:  NM_001098202
Protein Refseq:  NP_001091672
MIM:  603825
UniProt ID:  Q14526
Chromosome Location:  17p13.3
Function:  DNA binding; histone deacetylase binding; metal ion binding; protein binding; sequence-specific DNA binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.