Recombinant Human AEBP2 Protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1531
Product Overview:  Human AEBP2 full-length ORF ( NP_694939.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.
Description:  AEBP2 (AE Binding Protein 2) is a Protein Coding gene. Diseases associated with AEBP2 include Waardenburg Syndrome, Type 4A. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Chromatin organization. GO annotations related to this gene include RNA polymerase II core promoter proximal region sequence-specific DNA binding and transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding.
Applications:  Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  59.4 kDa
Species:  Human
Tag:  GST
Amino Acid Sequence:  MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  AEBP2 AE binding protein 2 [ Homo sapiens ]
Gene ID NCBI:  121536
Official Symbol:  AEBP2
Synonyms:  AEBP2; AE binding protein 2; zinc finger protein AEBP2; MGC17922; AE-binding protein 2; adipocyte enhancer-binding protein 2; AE(adipocyte enhancer)-binding protein 2;
mRNA Refseq:  NM_001114176
Protein Refseq:  NP_001107648
UniProt ID:  Q6ZN18

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart