| Cat.No.: | PE-1531 |
| Product Overview: | Human AEBP2 full-length ORF ( NP_694939.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | AEBP2 (AE Binding Protein 2) is a Protein Coding gene. Diseases associated with AEBP2 include Waardenburg Syndrome, Type 4A. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Chromatin organization. GO annotations related to this gene include RNA polymerase II core promoter proximal region sequence-specific DNA binding and transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding. |
| Applications: | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 59.4 kDa |
| Species: | Human |
| Tag: | GST |
| Amino Acid Sequence: | MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | AEBP2 AE binding protein 2 [ Homo sapiens ] |
| Gene ID NCBI: | 121536 |
| Official Symbol: | AEBP2 |
| Synonyms: | AEBP2; AE binding protein 2; zinc finger protein AEBP2; MGC17922; AE-binding protein 2; adipocyte enhancer-binding protein 2; AE(adipocyte enhancer)-binding protein 2; |
| mRNA Refseq: | NM_001114176 |
| Protein Refseq: | NP_001107648 |
| UniProt ID: | Q6ZN18 |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-1528 | Recombinant Human AEBP2, His-tagged | Inquiry |
| PE-1529 | Recombinant Zebrafish AEBP2 | Inquiry |
| PE-1530 | Recombinant Mouse AEBP2 Protein | Inquiry |
| PE-1531 | Recombinant Human AEBP2 Protein, GST-tagged | Inquiry |
| PE-1641 | EZH2 (Y641S) /EED/SUZ12/RbAp48/AEBP2, His-tag | Inquiry |
| Related Gene / Proteins | |||
| AEBP2 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.