| Cat.No.: | PE-1488 |
| Product Name: | Recombinant Human MORF4L2, His-tagged |
| Product Overview: | Recombinant full length Human Mortality Factor 4 like 2 with an N terminal His tag; 308 amino acids with the tag, predicted MWt: 34.4 kDa. |
| Description: | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 34.400kDa |
| Purity: | >90% by SDS-PAGE |
| Species: | Human |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL |
| Sequence Similarities: | Belongs to the MRG family. |
| Expression System: | E. coli |
| Protein Length: | 288 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | MORF4L2 mortality factor 4 like 2 [ Homo sapiens ] |
| Gene ID NCBI: | 9643 |
| Official Symbol: | MORF4L2 |
| Synonyms: | MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX; |
| mRNA Refseq: | NM_001142425 |
| Protein Refseq: | NP_001135897 |
| MIM: | 300409 |
| UniProt ID: | Q15014 |
| Chromosome Location: | Xq22 |
| Function: | protein binding; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0174 | MOZ-IN-3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0221 | Recombinant Human MORF4L2 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0695 | MORC2 Polyclonal Antibody | Inquiry |
| EAb-0779 | MORC2 Polyclonal Antibody, HRP Conjugated | Inquiry |
| Related Gene / Proteins | |||
| MOF | MORC2 | MORC3 | MORF |
| MORF4L2 | MOZ | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
