Recombinant Human MORF4L2, His-tagged

Inquiry

  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1488
Product Overview:  Recombinant full length Human Mortality Factor 4 like 2 with an N terminal His tag; 308 amino acids with the tag, predicted MWt: 34.4 kDa.
Description:  Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  34.400kDa
Purity:  >90% by SDS-PAGE
Species:  Human
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
Sequence Similarities:  Belongs to the MRG family.
Expression System:  E. coli
Protein Length:  288 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  MORF4L2 mortality factor 4 like 2 [ Homo sapiens ]
Gene ID NCBI:  9643
Official Symbol:  MORF4L2
Synonyms:  MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX;
mRNA Refseq:  NM_001142425
Protein Refseq:  NP_001135897
MIM:  300409
UniProt ID:  Q15014
Chromosome Location:  Xq22
Function:  protein binding;
Product Types
◆ Bioactive Small Molecules
BSM-0174 MOZ-IN-3 Inquiry
◆ Synthetic Peptides
SP-0174 Human KAT8 / MYST1 / MOF peptide Inquiry
◆ Extracts & Lysates
EL-0221 Recombinant Human MORF4L2 293 Cell Lysate Inquiry
◆ Antibodies
EAb-0695 MORC2 Polyclonal Antibody Inquiry
EAb-0779 MORC2 Polyclonal Antibody, HRP Conjugated Inquiry
Related Gene / Proteins
MOF MORC2 MORC3 MORF
MORF4L2 MOZ

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.