Recombinant Human PRDM16, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1485
Product Overview:  Recombinant fragment, corresponding to amino acids 984-1275 of Human PRDM16 with N terminal His tag; 292 amino acids, 39kDa.
Description:  The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Tissue Specificity:  Expressed in uterus and kidney.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 108 μl aqua dest.
Tag:  His
Amino Acid Sequence:  DRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLD RHLKKHEHENAPVSQHPGVLTNHLGTSASSPTSESDNH ALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQD DTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAED HEGGLLALEPMPTFGKGLDLRRAAEEAFEVKDVLNSTLDS EALKHTLCRQAKNQAYAMMLSLSEDTPLHTPSQGSLDA WLKVTGATSESGAFHPINHL
Sequence Similarities:  Contains 10 C2H2-type zinc fingers.Contains 1 SET domain.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  PRDM16 PR domain containing 16 [ Homo sapiens ]
Gene ID NCBI:  63976
Official Symbol:  PRDM16
Synonyms:  PRDM16; PR domain containing 16; PR domain zinc finger protein 16; KIAA1675; MDS1/EVI1 like; MEL1; MGC166915; PFM13; transcription factor MEL1;
mRNA Refseq:  NM_199454
Protein Refseq:  NP_955533
MIM:  605557
UniProt ID:  Q9HAZ2
Chromosome Location:  1p36.23-p33
Function:  SMAD binding; metal ion binding; protein binding; sequence-specific DNA binding; transcription coactivator activity;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart