Recombinant Human MSH6, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1474
Product Name:  Recombinant Human MSH6, GST-tagged
Product Overview:  Recombinant Human MSH6(931 a.a. - 1030 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description:  This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.
Applications:  ELISA; WB-Re; AP; Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  36.74 kDa
Species:  Human
Tag:  GST
Amino Acid Sequence:  AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKR YWTKTIEKKLANLINAEERRDVSLK
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  MSH6 mutS homolog 6 [ Homo sapiens (human) ]
Gene ID NCBI:  2956
Synonyms:  MSH6; GTBP; HSAP; p160; GTMBP; HNPCC5; mutS homolog 6; DNA mismatch repair protein Msh6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein
mRNA Refseq:  NM_000179
Protein Refseq:  NP_000170
MIM:  600678
Chromosome Location:  2p16
Function:  contributes_to ADP binding; contributes_to ATPase activity; contributes_to MutLalpha complex binding

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.