| Cat.No.: | PE-1462 |
| Product Overview: | Recombinant fragment, corresponding to amino acids 359-538 of Human RbBP5 with an N terminal His tag. Predicted mwt: 20 kDa; |
| Description: | This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. The encoded protein binds directly to retinoblastoma protein, which regulates cell proliferation. It interacts preferentially with the underphosphorylated retinoblastoma protein via the E1A-binding pocket B. Three alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. |
| Tissue Specificity: | Ubiquitously expressed. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 148 μl distilled water. |
| Tag: | His |
| Amino Acid Sequence: | KSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKA LLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEK KRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVK GDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEG SAKGKVQAELSQPLTAGGAISELL |
| Sequence Similarities: | Contains 6 WD repeats. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | RBBP5 retinoblastoma binding protein 5 [ Homo sapiens ] |
| Gene ID NCBI: | 5929 |
| Official Symbol: | RBBP5 |
| Synonyms: | RBBP5; retinoblastoma binding protein 5; retinoblastoma-binding protein 5; RBQ3; SWD1; Set1c WD40 repeat protein; homolog (S. cerevisiae); |
| mRNA Refseq: | NM_001193272 |
| Protein Refseq: | NP_001180201 |
| MIM: | 600697 |
| UniProt ID: | Q15291 |
| Chromosome Location: | 1q32 |
| Function: | contributes_to histone methyltransferase activity (H3-K4 specific); methylated histone residue binding; protein binding; transcription regulatory region DNA binding; |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| EAb-0181 | RBM26 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| EL-0216 | Recombinant Human RBBP5 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0118 | Human RBBP7 Knockout Cell Line 5bp deletion | Inquiry |
| Related Gene / Proteins | |||
| RB1 | RbAp46 | RbAp48 | RBB4L |
| RBBP2 | RBBP4 | RBBP5 | RBBP7 |
| RBBP9 | RBM11 | RBM18 | RBM26 |
| RBM3 | RBM34 | RBM38 | RBM39 |
| RBM41 | RBM42 | RBM46 | RBM5 More > |
| RBM7 | RBMS1 | RBMS2 | RBMS3 |
| RBMY1A1 | RBMY1F | RBPJ | RBPMS |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.