Recombinant Human CD1D


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1439
Product Overview:  Recombinant full length Human CD1d with N terminal proprietary tag; predicted MW 62.59 kDa.
Description:  This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail.
Tissue Specificity:  Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  62.590kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSS WTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQ WETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVN LAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVG FTSRFKRQTSYQGVL
Sequence Similarities:  Contains 1 Ig-like (immunoglobulin-like) domain.
Expression System:  Wheat germ
Protein Length:  335 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  CD1D CD1d molecule [ Homo sapiens ]
Gene ID NCBI:  912
Official Symbol:  CD1D
Synonyms:  CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d;
mRNA Refseq:  NM_001766
Protein Refseq:  NP_001757
MIM:  188410
UniProt ID:  P15813
Chromosome Location:  1q22-q23
Function:  beta-2-microglobulin binding; exogenous lipid antigen binding; histone binding; receptor activity;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart