Recombinant Human H3F3B Protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1413
Product Name:  Recombinant Human H3F3B Protein, GST-tagged
Product Overview:  Recombinant Human H3F3B protein (3-136 aa) was expressed in E. coli with GST tag.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  85 %
Species:  Human
Formulation:  Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
Tag:  GST
Amino Acid Sequence:  RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Reconstitution:  Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  H3F3B H3 histone, family 3B (H3.3B) [ Homo sapiens ]
Gene ID NCBI:  3021
Official Symbol:  H3F3B
Synonyms:  H3F3B; H3 histone, family 3B (H3.3B); histone H3.3; H3.3B; H3 histone, family 3A; H3F3A;
mRNA Refseq:  NM_005324
Protein Refseq:  NP_005315
MIM:  601058
UniProt ID:  P84243

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.