Recombinant Human ELP2, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1400
Product Overview:  Recombinant fragment, corresponding to amino acids 552-826 of Human STATIP1 with an N terminal His tag. 34 kDa ;
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 163 μl distilled water.
Tag:  His
Amino Acid Sequence:  LQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKK EHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFL LAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIE HNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLE CGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNK CAL
Sequence Similarities:  Belongs to the WD repeat ELP2 family.Contains 14 WD repeats.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  ELP2 elongation protein 2 homolog (S. cerevisiae) [ Homo sapiens ]
Gene ID NCBI:  55250
Official Symbol:  ELP2
Synonyms:  ELP2; elongation protein 2 homolog (S. cerevisiae); signal transducer and activator of transcription 3 interacting protein 1 , STATIP1; elongator complex protein 2; FLJ10879; StIP;
mRNA Refseq:  NM_001242879
Protein Refseq:  NP_001229808
UniProt ID:  Q6IA86
Chromosome Location:  18q12.1
Function:  contributes_to DNA binding; protein kinase binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart