Cat.No.: | PE-1400 |
Product Name: | Recombinant Human ELP2, His-tagged |
Product Overview: | Recombinant fragment, corresponding to amino acids 552-826 of Human STATIP1 with an N terminal His tag. 34 kDa ; |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Species: | Human |
Formulation: | Lyophilised:Reconstitute with 163 μl distilled water. |
Tag: | His |
Amino Acid Sequence: | LQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKK EHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFL LAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIE HNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLE CGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNK CAL |
Sequence Similarities: | Belongs to the WD repeat ELP2 family.Contains 14 WD repeats. |
Expression System: | E. coli |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | ELP2 elongation protein 2 homolog (S. cerevisiae) [ Homo sapiens ] |
Gene ID NCBI: | 55250 |
Official Symbol: | ELP2 |
Synonyms: | ELP2; elongation protein 2 homolog (S. cerevisiae); signal transducer and activator of transcription 3 interacting protein 1 , STATIP1; elongator complex protein 2; FLJ10879; StIP; |
mRNA Refseq: | NM_001242879 |
Protein Refseq: | NP_001229808 |
UniProt ID: | Q6IA86 |
Chromosome Location: | 18q12.1 |
Function: | contributes_to DNA binding; protein kinase binding; |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0191 | Recombinant Human ELP3 Cell Lysate | Inquiry |
EL-0199 | Recombinant Human ELP2 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0314 | ELAVL3 Polyclonal Antibody | Inquiry |
EAb-1079 | ELP3 Polyclonal Antibody, HRP Conjugated | Inquiry |
EAb-1082 | ELP3 Polyclonal Antibody, FITC Conjugated | Inquiry |
Related Gene / Proteins | |||
ELAVL3 | ELE1 | Elk-1 | ELP2 |
ELP3 | ELP4 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools