Cat.No.: | PE-1384 |
Product Name: | Recombinant Human KDM5A |
Product Overview: | Recombinant fragment of Human KDM5A / Jarid1A / RBBP2 with proprietary tag, 36.63kDa. |
Description: | The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. |
Applications: | Useful for Antibody Production and Protein Array |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 36.630kDa inclusive of tags |
Species: | Human |
Amino Acid Sequence: | KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF |
Sequence Similarities: | Belongs to the JARID1 histone demethylase family.Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain.Contains 3 PHD-type zinc fingers. |
Expression System: | Wheat germ |
Protein Length: | 100 amino acids |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | KDM5A lysine (K)-specific demethylase 5A [ Homo sapiens ] |
Gene ID NCBI: | 5927 |
Official Symbol: | KDM5A |
Synonyms: | KDM5A; lysine (K)-specific demethylase 5A; JARID1A, jumonji, AT rich interactive domain 1A , Jumonji, AT rich interactive domain 1A (RBBP2 like) , RBBP2, retinoblastoma binding protein 2; lysine-specific demethylase 5A; |
mRNA Refseq: | NM_001042603 |
Protein Refseq: | NP_001036068 |
MIM: | 180202 |
UniProt ID: | P29375 |
Chromosome Location: | 12p11 |
Function: | DNA binding; chromatin binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen in; |
Product Types | ||
◆ Cell Lines | ||
CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
KDM1 | KDM1A | KDM1B | KDM2 |
KDM2A | KDM2B | KDM3A | KDM3B |
KDM4 | KDM4A | KDM4B | KDM4C |
KDM4D | KDM4E | KDM5 | KDM5A |
KDM5B | KDM5C | KDM5D | KDM6A More > |
KDM6B | KDM6C | KDM7 | KDM7A |
KDM7B | KDM8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools