Recombinant Human SETD3, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1342
Product Name:  Recombinant Human SETD3, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 443-594 of Human SETD3 With N terminal His tag; 152 amino acids, 40 kDa.
Description:  SETD3 contains 1 SET domain. The function of the SETD3 protein remains unknown. There are 3 isoforms produced by alternative splicing.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitution with 64 μl aqua dest.
Tag:  His
Amino Acid Sequence:  TTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSA AVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLP LVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENS IPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SETD3 SET domain containing 3 [ Homo sapiens ]
Gene ID NCBI:  84193
Official Symbol:  SETD3
Synonyms:  SETD3; SET domain containing 3; C14orf154, chromosome 14 open reading frame 154; histone-lysine N-methyltransferase setd3; FLJ23027;
mRNA Refseq:  NM_032233
Protein Refseq:  NP_115609
UniProt ID:  Q86TU7
Chromosome Location:  14q32.2
Function:  histone methyltransferase activity (H3-K36 specific); methyltransferase activity; transcription coactivator activity; transferase activity;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.