Recombinant Human TADA3, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1337
Product Name:  Recombinant Human TADA3, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 87-432 of Human TADA3L with N terminal His tag. Predicted MWt 40 kDa;
Description:  Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 54 μl aqua dest.
Tag:  His
Amino Acid Sequence:  GRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNL QPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCAD ITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQ EDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDAL LKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPME DSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLES RIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELK ALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVM DAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLL DG
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  TADA3 transcriptional adaptor 3 [ Homo sapiens ]
Gene ID NCBI:  10474
Official Symbol:  TADA3
Synonyms:  TADA3; transcriptional adaptor 3; TADA3L, transcriptional adaptor 3 (NGG1 homolog, yeast) like; transcriptional adapter 3; ADA3; FLJ20221; FLJ21329; hADA3; NGG1;
mRNA Refseq:  NM_006354
Protein Refseq:  NP_006345
MIM:  602945
UniProt ID:  O75528
Chromosome Location:  3p25.3
Function:  contributes_to histone acetyltransferase activity; ligand-dependent nuclear receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein domain specific binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.