Cat.No.: | PE-1295 |
Product Name: | Recombinant Human ASF1A protein, T7/His-tagged |
Product Overview: | Recombinant human ASF1a (204 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Purity: | >90% by SDS-PAGE |
Species: | Human |
Formulation: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
Tag: | T7/His |
Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGEFAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSA ESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELR ENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLE SHMDCM |
Expression System: | E. coli |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ] |
Gene ID NCBI: | 25842 |
Official Symbol: | ASF1A |
Synonyms: | ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146; |
mRNA Refseq: | NM_014034 |
Protein Refseq: | NP_054753 |
MIM: | 609189 |
UniProt ID: | Q9Y294 |
Chromosome Location: | 6q22.31 |
Function: | chromatin binding; histone binding; protein binding; |
Product Types | ||
◆ Cell Lines | ||
CL-0018 | Human ASH1L Knockout Cell Line 53bp deletion | Inquiry |
CL-0019 | Human ASXL2 Knockout Cell Line 1bp insertion | Inquiry |
◆ Extracts & Lysates | ||
EL-0162 | Recombinant Human ASH2L 293 Cell Lysate | Inquiry |
EL-0173 | Recombinant Human ASF1A 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0168 | ASH2 Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
ASB10 | ASB11 | ASB13 | ASB6 |
ASB7 | ASB8 | ASB9 | ASF1 |
ASH1L | ASH2 | ASXL2 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools