Recombinant Human ASF1A protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1295
Product Name:  Recombinant Human ASF1A protein, T7/His-tagged
Product Overview:  Recombinant human ASF1a (204 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE
Species:  Human
Formulation:  0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHENLYFQGEFAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSA ESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELR ENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLE SHMDCM
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ]
Gene ID NCBI:  25842
Official Symbol:  ASF1A
Synonyms:  ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146;
mRNA Refseq:  NM_014034
Protein Refseq:  NP_054753
MIM:  609189
UniProt ID:  Q9Y294
Chromosome Location:  6q22.31
Function:  chromatin binding; histone binding; protein binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.