| Cat.No.: | PE-1294 |
| Product Overview: | Recombinant Human ASF1A(Met1-Met204) fused with a T7 tag at the N-terminus, 6His tag at the C-terminus was expressed in E. coli. |
| Description: | Human Histone Chaperone ASF1A (ASF1A) belongs to the H3/H4 family of histone chaperone proteins. ASF1A is ubiquitously expressed in many cells and tissues, interacting with histones H3 and H4. ASF1A cooperates with Chromatin Assembly Factor 1 to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. In addition, ASF1A is necessary for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Species: | Human |
| Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 150mM NaCl, pH 8.0. |
| Tag: | His/T7 |
| Amino Acid Sequence: | MASMTGGQQMGRGSMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNE YTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPS ASKGWSTSENSLNVMLESHMDCMLEHHHHHH |
| Endotoxin: | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Reconstitution: | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ] |
| Gene ID NCBI: | 25842 |
| Official Symbol: | ASF1A |
| Synonyms: | ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146; |
| mRNA Refseq: | NM_014034 |
| Protein Refseq: | NP_054753 |
| MIM: | 609189 |
| UniProt ID: | Q9Y294 |
| Chromosome Location: | 6q22.31 |
| Function: | chromatin binding; histone binding; protein binding; |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0018 | Human ASH1L Knockout Cell Line 53bp deletion | Inquiry |
| CL-0019 | Human ASXL2 Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0162 | Recombinant Human ASH2L 293 Cell Lysate | Inquiry |
| EL-0173 | Recombinant Human ASF1A 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0168 | ASH2 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| ASB10 | ASB11 | ASB13 | ASB6 |
| ASB7 | ASB8 | ASB9 | ASF1 |
| ASH1L | ASH2 | ASXL2 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.