Cat.No.: | PE-1294 |
Product Name: | Recombinant Human ASF1A protein, His/T7-tagged |
Product Overview: | Recombinant Human ASF1A(Met1-Met204) fused with a T7 tag at the N-terminus, 6His tag at the C-terminus was expressed in E. coli. |
Description: | Human Histone Chaperone ASF1A (ASF1A) belongs to the H3/H4 family of histone chaperone proteins. ASF1A is ubiquitously expressed in many cells and tissues, interacting with histones H3 and H4. ASF1A cooperates with Chromatin Assembly Factor 1 to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. In addition, ASF1A is necessary for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Species: | Human |
Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 150mM NaCl, pH 8.0. |
Tag: | His/T7 |
Amino Acid Sequence: | MASMTGGQQMGRGSMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNE YTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPS ASKGWSTSENSLNVMLESHMDCMLEHHHHHH |
Endotoxin: | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Reconstitution: | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Expression System: | E. coli |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ] |
Gene ID NCBI: | 25842 |
Official Symbol: | ASF1A |
Synonyms: | ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146; |
mRNA Refseq: | NM_014034 |
Protein Refseq: | NP_054753 |
MIM: | 609189 |
UniProt ID: | Q9Y294 |
Chromosome Location: | 6q22.31 |
Function: | chromatin binding; histone binding; protein binding; |
Product Types | ||
◆ Cell Lines | ||
CL-0018 | Human ASH1L Knockout Cell Line 53bp deletion | Inquiry |
CL-0019 | Human ASXL2 Knockout Cell Line 1bp insertion | Inquiry |
◆ Extracts & Lysates | ||
EL-0162 | Recombinant Human ASH2L 293 Cell Lysate | Inquiry |
EL-0173 | Recombinant Human ASF1A 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0168 | ASH2 Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
ASB10 | ASB11 | ASB13 | ASB6 |
ASB7 | ASB8 | ASB9 | ASF1 |
ASH1L | ASH2 | ASXL2 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools