Recombinant Human ASF1A protein, His/T7-tagged

Inquiry

  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1294
Product Overview:  Recombinant Human ASF1A(Met1-Met204) fused with a T7 tag at the N-terminus, 6His tag at the C-terminus was expressed in E. coli.
Description:  Human Histone Chaperone ASF1A (ASF1A) belongs to the H3/H4 family of histone chaperone proteins. ASF1A is ubiquitously expressed in many cells and tissues, interacting with histones H3 and H4. ASF1A cooperates with Chromatin Assembly Factor 1 to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. In addition, ASF1A is necessary for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  Greater than 95% as determined by reducing SDS-PAGE.
Species:  Human
Formulation:  Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 150mM NaCl, pH 8.0.
Tag:  His/T7
Amino Acid Sequence:  MASMTGGQQMGRGSMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNE YTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPS ASKGWSTSENSLNVMLESHMDCMLEHHHHHH
Endotoxin:  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Reconstitution:  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ]
Gene ID NCBI:  25842
Official Symbol:  ASF1A
Synonyms:  ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146;
mRNA Refseq:  NM_014034
Protein Refseq:  NP_054753
MIM:  609189
UniProt ID:  Q9Y294
Chromosome Location:  6q22.31
Function:  chromatin binding; histone binding; protein binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.