| Cat.No.: | PE-1285 |
| Product Name: | Recombinant Human CBX5 protein, T7/His-tagged |
| Product Overview: | Recombinant human CBX5 cDNA (190 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE |
| Species: | Human |
| Formulation: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEE HNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLE PEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | CBX5 chromobox homolog 5 [ Homo sapiens ] |
| Gene ID NCBI: | 23468 |
| Official Symbol: | CBX5 |
| Synonyms: | CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha) , chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha; HP1-ALPHA; antigen p25; HP1 alpha homolog; heterochromatin protein 1-alpha; heterochromatin protein 1 homolog alpha; chromobox homolog 5 (HP1 alpha homolog, Drosophila); HP1A; |
| mRNA Refseq: | NM_001127321 |
| Protein Refseq: | NP_001120793 |
| MIM: | 604478 |
| UniProt ID: | P45973 |
| Chromosome Location: | 12q13.13 |
| Function: | chromatin binding; enzyme binding; histone deacetylase binding; methylated histone residue binding; protein binding; protein binding, bridging; repressing transcription factor binding; |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0053 | Human CBX5 Knockout Cell Line 2bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0146 | CBX5 Polyclonal Antibody | Inquiry |
| EAb-0148 | CBX3 Polyclonal Antibody | Inquiry |
| EAb-0150 | CBX2 Polyclonal Antibody | Inquiry |
| EAb-0153 | CBFb Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| CBFb | CBX2 | CBX3 | CBX4 |
| CBX5 | CBX6 | CBX7 | CBX8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
