Recombinant Human CBX5 protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1285
Product Name:  Recombinant Human CBX5 protein, T7/His-tagged
Product Overview:  Recombinant human CBX5 cDNA (190 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE
Species:  Human
Formulation:  1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHENLYFQGGEFGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEE HNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLE PEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  CBX5 chromobox homolog 5 [ Homo sapiens ]
Gene ID NCBI:  23468
Official Symbol:  CBX5
Synonyms:  CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha) , chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha; HP1-ALPHA; antigen p25; HP1 alpha homolog; heterochromatin protein 1-alpha; heterochromatin protein 1 homolog alpha; chromobox homolog 5 (HP1 alpha homolog, Drosophila); HP1A;
mRNA Refseq:  NM_001127321
Protein Refseq:  NP_001120793
MIM:  604478
UniProt ID:  P45973
Chromosome Location:  12q13.13
Function:  chromatin binding; enzyme binding; histone deacetylase binding; methylated histone residue binding; protein binding; protein binding, bridging; repressing transcription factor binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.