Cat.No.: | PE-1232 |
Product Name: | Recombinant Human NCOA3, GST-tagged |
Product Overview: | Recombinant Human NCOA3(251 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
Description: | The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Several transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein. |
Applications: | ELISA; WB-Re; AP; Array |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Molecular Weight: | 37.84 kDa |
Species: | Human |
Tag: | GST |
Amino Acid Sequence: | RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLN GHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR |
Expression System: | Wheat germ |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | NCOA3 nuclear receptor coactivator 3 [ Homo sapiens (human) ] |
Gene ID NCBI: | 8202 |
Synonyms: | NCOA3; ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42; nuclear receptor coactivator 3; nuclear receptor coactivator 3; CBP-interacting protein; receptor-associated coactivator 3; amplified in breast cancer 1 protein; steroid receptor coactivator protein 3; class E basic helix-loop-helix protein 42; thyroid hormone receptor activator molecule 1; NP_001167558.1; EC 2.3.1.48; NP_001167559.1; NP_006525.2; NP_858045.1 |
mRNA Refseq: | NM_006534 |
Protein Refseq: | NP_006525 |
MIM: | 601937 |
Chromosome Location: | 20q12 |
Function: | androgen receptor binding; histone acetyltransferase activity; ligand-dependent nuclear receptor binding |
Product Types | ||
◆ Research Kits | ||
EKIT-0046 | HDAC3/NCOR1 fluorometric drug discovery Kit | Inquiry |
◆ Proteins & Enzymes | ||
PE-0046 | Recombinant Human NCOR1, GST-tagged | Inquiry |
◆ Antibodies | ||
EAb-0065 | NCOA1 Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0143 | Recombinant Human NCOA1 293 Cell Lysate | Inquiry |
EL-0144 | Recombinant Human NCOA2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
NCAPD3 | NCAPH2 | NCOA1 | NCOA2 |
NCOA3 | NCoA4 | NCOR1 | ncor2 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools