Recombinant Human NCOA3, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1232
Product Overview:  Recombinant Human NCOA3(251 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description:  The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Several transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.
Applications:  ELISA; WB-Re; AP; Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  37.84 kDa
Species:  Human
Tag:  GST
Amino Acid Sequence:  RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLN GHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
Expression System:  Wheat germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  NCOA3 nuclear receptor coactivator 3 [ Homo sapiens (human) ]
Gene ID NCBI:  8202
Synonyms:  NCOA3; ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42; nuclear receptor coactivator 3; nuclear receptor coactivator 3; CBP-interacting protein; receptor-associated coactivator 3; amplified in breast cancer 1 protein; steroid receptor coactivator protein 3; class E basic helix-loop-helix protein 42; thyroid hormone receptor activator molecule 1; NP_001167558.1; EC 2.3.1.48; NP_001167559.1; NP_006525.2; NP_858045.1
mRNA Refseq:  NM_006534
Protein Refseq:  NP_006525
MIM:  601937
Chromosome Location:  20q12
Function:  androgen receptor binding; histone acetyltransferase activity; ligand-dependent nuclear receptor binding
Product Types
◆ Research Kits
EKIT-0046 HDAC3/NCOR1 fluorometric drug discovery Kit Inquiry
◆ Proteins & Enzymes
PE-0046 Recombinant Human NCOR1, GST-tagged Inquiry
◆ Antibodies
EAb-0065 NCOA1 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0143 Recombinant Human NCOA1 293 Cell Lysate Inquiry
EL-0144 Recombinant Human NCOA2 293 Cell Lysate Inquiry
Related Gene / Proteins
NCAPD3 NCAPH2 NCOA1 NCOA2
NCOA3 NCoA4 NCOR1 ncor2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart