Recombinant Human ASH2L protein, GST-tagged

Inquiry

  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1230
Product Overview:  Human ASH2L full-length ORF ( AAH15936.1, 1 a.a. - 534 a.a.) recombinant protein with GST-tag at N-terminal.
Description:  ASH2L (ASH2 Like Histone Lysine Methyltransferase Complex Subunit) is a Protein Coding gene. Diseases associated with ASH2L include Kabuki Syndrome 1. Among its related pathways are Signaling by Wnt and Chromatin organization. GO annotations related to this gene include transcription regulatory region DNA binding and histone methyltransferase activity (H3-K4 specific).
Applications:  Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  86.6 kDa
Species:  Human
Tag:  GST
Amino Acid Sequence:  MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  ASH2L ash2 (absent, small, or homeotic)-like (Drosophila) [ Homo sapiens ]
Gene ID NCBI:  9070
Official Symbol:  ASH2L
Synonyms:  ASH2L; ash2 (absent, small, or homeotic)-like (Drosophila); ash2 (absent, small, or homeotic, Drosophila, homolog) like , ASH2L1; set1/Ash2 histone methyltransferase complex subunit ASH2; ASH2; ASH2L2; Bre2; ASH2-like protein; ASH2L1;
mRNA Refseq:  NM_001105214
Protein Refseq:  NP_001098684
MIM:  604782
UniProt ID:  Q9UBL3

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.