Recombinant Human DNAJC2, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1207
Product Name:  Recombinant Human DNAJC2, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 189-621 of Human DNAJC2 with N terminal His tag; Predicted MWt 51kDa.
Description:  This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 125 μl aqua dest.
Tag:  His
Amino Acid Sequence:  NSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFS YLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRI RTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRK EQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEK DIQKKAIKKERQKLRNSCKTWNHFSDNEAERVKMMEEVEK LCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINE QIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDD LQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTA KDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQ ADNATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTP ERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQ VLNASRAKK
Sequence Similarities:  Contains 1 J domain.Contains 2 SANT domains.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  DNAJC2 DnaJ (Hsp40) homolog, subfamily C, member 2 [ Homo sapiens ]
Gene ID NCBI:  27000
Official Symbol:  DNAJC2
Synonyms:  DNAJC2; DnaJ (Hsp40) homolog, subfamily C, member 2; ZRF1, zuotin related factor 1; dnaJ homolog subfamily C member 2; MPHOSPH11; MPP11; ZUO1; zuotin;
mRNA Refseq:  NM_014377
Protein Refseq:  NP_055192
MIM:  605502
UniProt ID:  Q99543
Chromosome Location:  7q22-q32
Function:  DNA binding; Hsp70 protein binding; chromatin binding; histone binding; ubiquitin binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.