| Cat.No.: | PE-1167 |
| Product Name: | Recombinant Human HisT4H4, His-tagged |
| Product Overview: | Recombinant full length Human Histone H4 with a proprietary tag; Predicted MWt 37.44 kDa including tag. |
| Description: | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37.440kDa inclusive of tags |
| Species: | Human |
| Tag: | His |
| Amino Acid Sequence: | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
| Expression System: | Wheat germ |
| Protein Length: | 103 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | HIST4H4 histone cluster 4, H4 [ Homo sapiens ] |
| Gene ID NCBI: | 121504 |
| Official Symbol: | HIST4H4 |
| Synonyms: | HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116; |
| mRNA Refseq: | NM_175054 |
| Protein Refseq: | NP_778224 |
| UniProt ID: | P62805 |
| Chromosome Location: | 12p12.3 |
| Product Types | ||
| ◆ Nucleosomes | ||
| NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
| NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
| SP-0010 | Histone H4 peptide (1-21) | Inquiry |
| SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
| Related Gene / Proteins | |||
| HIC1 | HIF1A | HIF1AN | HINFP |
| HIPK1 | HIPK2 | HIRA | Histone |
| Histone H1 | Histone H2A | Histone H2B | Histone H3 |
| Histone H4 | HIV-1 reverse transcriptase | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools