Recombinant Human HisT4H4, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1167
Product Name:  Recombinant Human HisT4H4, His-tagged
Product Overview:  Recombinant full length Human Histone H4 with a proprietary tag; Predicted MWt 37.44 kDa including tag.
Description:  Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  37.440kDa inclusive of tags
Species:  Human
Tag:  His
Amino Acid Sequence:  MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Expression System:  Wheat germ
Protein Length:  103 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  HIST4H4 histone cluster 4, H4 [ Homo sapiens ]
Gene ID NCBI:  121504
Official Symbol:  HIST4H4
Synonyms:  HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116;
mRNA Refseq:  NM_175054
Protein Refseq:  NP_778224
UniProt ID:  P62805
Chromosome Location:  12p12.3

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.