Recombinant Human KDM1A protein


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1143
Product Name:  Recombinant Human KDM1A protein
Product Overview:  Recombinant Human KDM1A(158-end) was expressed in E. coli.
Description:  This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.
Applications:  Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  77.9 kDa
Purity:  >90%
Species:  Human
Formulation:  40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 1 mM DTT, 1 mM EDTA, 0.05% Tween-20, and 20% glycerol.
Amino Acid Sequence:  GPLGSPEFAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDN PKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQ SFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKE KDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNK MVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYL SSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYT ASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVF WDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPK ETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGL REAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Activity:  >20.6 pmol/min/µg
Expression System:  E. coli
Concentrations:  0.3 mg/ml
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  KDM1A lysine (K)-specific demethylase 1A [ Homo sapiens ]
Gene ID NCBI:  23028
Official Symbol:  KDM1A
Synonyms:  KDM1A; lysine (K)-specific demethylase 1A; amine oxidase (flavin containing) domain 2 , AOF2, KDM1, lysine (K) specific demethylase 1; lysine-specific histone demethylase 1A; BHC110; KIAA0601; LSD1; lysine (K)-specific demethylase 1; BRAF35-HDAC complex protein BHC110; lysine-specific histone demethylase 1; amine oxidase (flavin containing) domain 2; FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit; flavin-containing amine oxidase domain-containing protein 2; AOF2; KDM1;
mRNA Refseq:  NM_015013
Protein Refseq:  NP_055828
MIM:  609132
UniProt ID:  O60341
Chromosome Location:  1p36.12
Function:  MRF binding; androgen receptor binding; chromatin binding; demethylase activity; enzyme binding; flavin adenine dinucleotide binding; histone demethylase activity; histone demethylase activity (H3-K4 specific); histone demethylase activity (H3-K9 specific); histone demethylase activity (H3-dimethyl-K4 specific); ligand-dependent nuclear receptor transcription coactivator activity; oxidoreductase activity; p53 binding; protein binding; transcription factor binding; transcription regulatory region DNA binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.