| Cat.No.: | PE-1143 |
| Product Name: | Recombinant Human KDM1A protein |
| Product Overview: | Recombinant Human KDM1A(158-end) was expressed in E. coli. |
| Description: | This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants. |
| Applications: | Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 77.9 kDa |
| Purity: | >90% |
| Species: | Human |
| Formulation: | 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 1 mM DTT, 1 mM EDTA, 0.05% Tween-20, and 20% glycerol. |
| Amino Acid Sequence: | GPLGSPEFAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDN PKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQ SFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKE KDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNK MVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYL SSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYT ASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVF WDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPK ETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGL REAGRIADQFLGAMYTLPRQATPGVPAQQSPSM |
| Activity: | >20.6 pmol/min/µg |
| Expression System: | E. coli |
| Concentrations: | 0.3 mg/ml |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | KDM1A lysine (K)-specific demethylase 1A [ Homo sapiens ] |
| Gene ID NCBI: | 23028 |
| Official Symbol: | KDM1A |
| Synonyms: | KDM1A; lysine (K)-specific demethylase 1A; amine oxidase (flavin containing) domain 2 , AOF2, KDM1, lysine (K) specific demethylase 1; lysine-specific histone demethylase 1A; BHC110; KIAA0601; LSD1; lysine (K)-specific demethylase 1; BRAF35-HDAC complex protein BHC110; lysine-specific histone demethylase 1; amine oxidase (flavin containing) domain 2; FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit; flavin-containing amine oxidase domain-containing protein 2; AOF2; KDM1; |
| mRNA Refseq: | NM_015013 |
| Protein Refseq: | NP_055828 |
| MIM: | 609132 |
| UniProt ID: | O60341 |
| Chromosome Location: | 1p36.12 |
| Function: | MRF binding; androgen receptor binding; chromatin binding; demethylase activity; enzyme binding; flavin adenine dinucleotide binding; histone demethylase activity; histone demethylase activity (H3-K4 specific); histone demethylase activity (H3-K9 specific); histone demethylase activity (H3-dimethyl-K4 specific); ligand-dependent nuclear receptor transcription coactivator activity; oxidoreductase activity; p53 binding; protein binding; transcription factor binding; transcription regulatory region DNA binding; |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
| CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
| CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KDM1 | KDM1A | KDM1B | KDM2 |
| KDM2A | KDM2B | KDM3A | KDM3B |
| KDM4 | KDM4A | KDM4B | KDM4C |
| KDM4D | KDM4E | KDM5 | KDM5A |
| KDM5B | KDM5C | KDM5D | KDM6A More > |
| KDM6B | KDM6C | KDM7 | KDM7A |
| KDM7B | KDM8 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools