| Cat.No.: | PE-1093 |
| Product Overview: | Recombinant fragment: FFFDGSTLEG YYVDDALQGQ GVYTYEDGGV LQGTYVDGEL NGPAQEYDTD GRLIFKGQYK DNIRHGVCWI YYPDGGSLVG EVNEDGEMTG EKIAYV, corresponding to amino acids 52-147 of Human KMT7 / SETD7/ SET7/9, with N-terminal proprietary tag, 61 kDa. |
| Description: | Histone-lysine N-methyltransferase SETD7 is an enzyme that in humans is encoded by the SETD7 gene. |
| Tissue Specificity: | Widely expressed. Expressed in pancreatic islets. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Tag: | GST |
| Amino Acid Sequence: | FFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYV |
| Sequence Similarities: | Belongs to the histone-lysine methyltransferase family. SET7 subfamily.Contains 3 MORN repeats.Contains 1 SET domain. |
| Activity: | Specific Activity: 140 pmol/min/mg.Assay conditions: 50 μl reaction mix (50 mMTRIS pH8.8, 5 mM MgCl2, 4 mM DTT, 20 μMS-adenosylhomocysteine, and 0-10 ng SET7/9)add to the wells coated with the substrate.Incubate for 1 hr. Add antibody againstmethylated K4 |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SETD7 SET domain containing (lysine methyltransferase) 7 [ Homo sapiens ] |
| Gene ID NCBI: | 80854 |
| Official Symbol: | SETD7 |
| Synonyms: | SETD7; SET domain containing (lysine methyltransferase) 7; histone-lysine N-methyltransferase SETD7; KIAA1717; KMT7; SET7; SET7/9; Set9; |
| mRNA Refseq: | NM_030648 |
| Protein Refseq: | NP_085151 |
| MIM: | 606594 |
| UniProt ID: | Q8WTS6 |
| Chromosome Location: | 4q31.1 |
| Function: | histone-lysine N-methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; p53 binding; protein binding; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Antibodies | ||
| EAb-0030 | SETD8 Polyclonal Antibody | Inquiry |
| EAb-0031 | SETDB1 Polyclonal Antibody | Inquiry |
| EAb-0032 | Setd1a Polyclonal Antibody | Inquiry |
| EAb-0033 | Setd1b Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| SENP3 | SENP8 | SET | SET1 |
| SET2 | SET7 | SET8 | SET9 |
| SETBP1 | SETD1A | SETD1B | SETD2 |
| SETD3 | SETD5 | SETD6 | SETD7 |
| SETD8 | SETD9 | SetDB1 | SETDB2 More > |
| SETMAR | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.