| Cat.No.: | PE-1071 |
| Product Overview: | Recombinant Human PRMT2 fused with GST tag at N-terminal was expressed in Insect cells. |
| Description: | PRMT2, protein arginine methyltransferase 2, arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. PRMT2 acts as an ERα-binding protein and enhances both its AF-1 and AF-2 transcriptional activity. Inhibit NF-kappa-B transcription by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding, which in turn renders cells susceptible to apoptosis. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 76 kDa |
| Purity: | >90% |
| Species: | Human |
| Formulation: | 50mM Tris-HCl, pH 7.5, 150mM NaCl, 10mM glutathione, 0.1mM EDTA, 0.25mM DTT, 0.1mM PMSF, 25% glycerol. |
| Tag: | GST |
| Amino Acid Sequence: | MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGC CGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIES ILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLF MMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR |
| Expression System: | Insect Cells |
| Concentrations: | 0.05μg/μl |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ] |
| Gene ID NCBI: | 3275 |
| Official Symbol: | PRMT2 |
| Synonyms: | PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1; |
| mRNA Refseq: | NM_001242864 |
| Protein Refseq: | NP_001229793 |
| MIM: | 601961 |
| UniProt ID: | P55345 |
| Chromosome Location: | 21q22.3 |
| Function: | androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; methyltransferase activity; peroxisome proliferator activated receptor binding; progesterone receptor binding |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| BSM-0047 | SGC707 | Inquiry |
| ◆ Antibodies | ||
| EAb-0048 | PRMT6 Polyclonal Antibody | Inquiry |
| EAb-0049 | PRMT7 Polyclonal Antibody | Inquiry |
| EAb-0050 | PRMT1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| Pr-SET7 | PRC1 | PRC2 | PRDM1 |
| PRDM10 | PRDM11 | PRDM12 | PRDM13 |
| PRDM14 | PRDM15 | PRDM16 | PRDM17 |
| PRDM2 | PRDM3 | PRDM4 | PRDM5 |
| PRDM6 | PRDM7 | PRDM8 | PRDM9 More > |
| PREP1 | PRIM2 | PRKAA2 | PRKCA |
| PRKCB | PRKCE | PRKDC | PRKRIP1 |
| PRMT | prmt1 | PRMT2 | PRMT3 |
| PRMT5 | prmt6 | PRMT7 | PRMT8 |
| PRMT9 | Progerin | Protamine 2 | Prox1 |
| PRPF31 | PRPF40A | PRSS12 | PRSS55 |
| PRTFDC1 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools