Recombinant Human PRMT2 protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1071
Product Name:  Recombinant Human PRMT2 protein, GST-tagged
Product Overview:  Recombinant Human PRMT2 fused with GST tag at N-terminal was expressed in Insect cells.
Description:  PRMT2, protein arginine methyltransferase 2, arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. PRMT2 acts as an ERα-binding protein and enhances both its AF-1 and AF-2 transcriptional activity. Inhibit NF-kappa-B transcription by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding, which in turn renders cells susceptible to apoptosis.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  76 kDa
Purity:  >90%
Species:  Human
Formulation:  50mM Tris-HCl, pH 7.5, 150mM NaCl, 10mM glutathione, 0.1mM EDTA, 0.25mM DTT, 0.1mM PMSF, 25% glycerol.
Tag:  GST
Amino Acid Sequence:  MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGC CGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIES ILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLF MMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Expression System:  Insect Cells
Concentrations:  0.05μg/μl
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Gene ID NCBI:  3275
Official Symbol:  PRMT2
Synonyms:  PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1;
mRNA Refseq:  NM_001242864
Protein Refseq:  NP_001229793
MIM:  601961
UniProt ID:  P55345
Chromosome Location:  21q22.3
Function:  androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; methyltransferase activity; peroxisome proliferator activated receptor binding; progesterone receptor binding

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.