Recombinant Human PRMT2, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1068
Product Name:  Recombinant Human PRMT2, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 286-433 of Human PRMT2 with an N terminal His tag. Predicted MWt: 18 kDa;
Description:  Protein arginine N-methyltransferase 2 is an enzyme that in humans is encoded by the PRMT2 gene.
Tissue Specificity:  Ubiquitous.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 102 μl aqua dest.
Tag:  His
Amino Acid Sequence:  SKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGE LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGP FHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVW RRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Sequence Similarities:  Belongs to the protein arginine N-methyltransferase family.Contains 1 SH3 domain.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Gene ID NCBI:  3275
Official Symbol:  PRMT2
Synonyms:  PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373;
mRNA Refseq:  NM_001242864
Protein Refseq:  NP_001229793
MIM:  601961
UniProt ID:  P55345
Chromosome Location:  21q22.3
Function:  androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.