Recombinant Human PRMT1 protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1067
Product Name:  Recombinant Human PRMT1 protein, T7/His-tagged
Product Overview:  Recombinant human PRMT1 cDNA (371 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE
Species:  Human
Formulation:  0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDM TSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSI SDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRAT LYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFC LQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDL DFTIDLDFKGQLCELSCSTDYRMR
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  PRMT1 protein arginine methyltransferase 1 [ Homo sapiens ]
Gene ID NCBI:  3276
Official Symbol:  PRMT1
Synonyms:  PRMT1; protein arginine methyltransferase 1; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 2 , HMT1 hnRNP methyltransferase like 2 (S. cerevisiae) , HRMT1L2; protein arginine N-methyltransferase 1; ANM1; HCP1; interferon receptor 1-bound protein 4; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; IR1B4; HRMT1L2;
mRNA Refseq:  NM_001207042
Protein Refseq:  NP_001193971
MIM:  602950
UniProt ID:  Q99873
Chromosome Location:  19q13
Function:  N-methyltransferase activity; N-methyltransferase activity; histone methyltransferase activity; histone methyltransferase activity (H4-R3 specific); methyltransferase activity; protein binding; transferase activity;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.