Recombinant Human EHMT1, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0995
Product Name:  Recombinant Human EHMT1, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 460-716 of Human KMT1D / GLP / Eu HMTase1 with N terminal His tag; 257 amino acids, 38kDa.
Description:  The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 103 μl aqua dest.
Tag:  His
Amino Acid Sequence:  SQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMR CWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRV VQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSR FINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAG EQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQA SAAQEAQEDGLPDTSSAAAADPL
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  EHMT1 euchromatic histone-lysine N-methyltransferase 1 [ Homo sapiens ]
Gene ID NCBI:  79813
Official Symbol:  EHMT1
Synonyms:  EHMT1; euchromatic histone-lysine N-methyltransferase 1; euchromatic histone methyltransferase 1; histone-lysine N-methyltransferase EHMT1; bA188C12.1; Eu HMTase1; FLJ12879; KIAA1876; KMT1D;
mRNA Refseq:  NM_024757
Protein Refseq:  NP_079033
MIM:  607001
UniProt ID:  Q9H9B1
Chromosome Location:  9
Function:  histone methyltransferase activity (H3-K27 specific); histone methyltransferase activity (H3-K9 specific); histone-lysine N-methyltransferase activity; metal ion binding; methyltransferase activity;
Product Types
◆ Bioactive Small Molecules
BSM-0025 BIX01294 (hydrochloride hydrate) Inquiry
BSM-0026 UNC0224 Inquiry
BSM-0027 UNC0321 (trifluoroacetate salt) Inquiry
◆ Cell Lines
CL-0059 Human EHMT1 Knockout Cell Line 7bp deletion Inquiry
CL-0060 Human EHMT2 Knockout Cell Line 34bp deletion Inquiry
Related Gene / Proteins
EHD2 EHMT1 EHMT2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.