Recombinant Human CDK1 protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0921
Product Name:  Recombinant Human CDK1 protein, T7/His-tagged
Product Overview:  Recombinant human CDK1 cDNA (297aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE
Species:  Human
Formulation:  1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHGNLYFQGGEFEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPST AIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSR RVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAEL ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDP AKRISGKMALNHPYFNDLDNQIKKM
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  CDK1 cyclin-dependent kinase 1 [ Homo sapiens ]
Gene ID NCBI:  983
Official Symbol:  CDK1
Synonyms:  CDK1; cyclin-dependent kinase 1; CDC2, cell division cycle 2, G1 to S and G2 to M; CDC28A; p34 protein kinase; cell cycle controller CDC2; cell division protein kinase 1; cell division control protein 2 homolog; cell division cycle 2, G1 to S and G2 to M; CDC2; P34CDC2; MGC111195; DKFZp686L20222;
mRNA Refseq:  NM_001170406
Protein Refseq:  NP_001163877
MIM:  116940
UniProt ID:  P06493
Chromosome Location:  10q21.2
Function:  ATP binding; Hsp70 protein binding; RNA polymerase II carboxy-terminal domain kinase activity; cyclin binding; cyclin-dependent protein kinase activity; cyclin-dependent protein kinase activity; histone kinase activity; nucleotide binding; protein binding

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.