Cat.No.: | PE-0885 |
Product Name: | Recombinant Human KAT2A, His-tagged |
Product Overview: | Recombinant full length Human KAT2A / GCN5 with an N termianl His tag; 477 amino acids with the tag; predicted MWt: 51.1 kDa. |
Description: | KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al. |
Tissue Specificity: | Expressed in all tissues tested, with most abundant expression in ovary. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 51.100kDa inclusive of tags |
Purity: | >90% by SDS-PAGE |
Species: | Human |
Tag: | His |
Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK |
Sequence Similarities: | Belongs to the GCN5 family.Contains 1 bromo domain.Contains 1 N-acetyltransferase domain. |
Expression System: | E. coli |
Protein Length: | 427 amino acids |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ] |
Gene ID NCBI: | 2648 |
Official Symbol: | KAT2A |
Synonyms: | KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b; |
mRNA Refseq: | NM_021078 |
Protein Refseq: | NP_066564 |
MIM: | 602301 |
UniProt ID: | Q92830 |
Chromosome Location: | 17q12-q21 |
Function: | H3 histone acetyltransferase activity; N-acetyltransferase activity; chromatin binding; histone acetyltransferase activity; contributes_to histone acetyltransferase activity; |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0073 | Anacardic Acid | Inquiry |
◆ Antibodies | ||
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
◆ Extracts & Lysates | ||
EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
Kaiso | KANSL2 | KAP1 | KAT13A |
KAT13D | KAT2A | KAT2B | KAT4 |
KAT5 | KAT6A | KAT6B | KAT7 |
KAT8 | KAT9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools