| Cat.No.: | PE-0879 |
| Product Name: | Recombinant Human TRIM24 protein, GST-tagged |
| Product Overview: | Recombinant Human TRIM24(432 a.a. - 569 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Description: | The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 40.81 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPS ISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | TRIM24 tripartite motif containing 24 [ Homo sapiens ] |
| Gene ID NCBI: | 8805 |
| Official Symbol: | TRIM24 |
| Synonyms: | TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA; |
| mRNA Refseq: | NM_015905 |
| Protein Refseq: | NP_056989 |
| MIM: | 603406 |
| UniProt ID: | O15164 |
| Chromosome Location: | 7q32-q34 |
| Function: | chromatin binding; estrogen response element binding; histone acetyl-lysine binding; ligand-dependent nuclear receptor binding; ligase activity; metal ion binding; NOT methylated histone residue binding; p53 binding; protein binding; protein kinase activity; receptor binding; sequence-specific DNA binding; transcription coactivator activity; ubiquitin-protein ligase activity; zinc ion binding; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0018 | Danusertib (PHA-739358) | Inquiry |
| BSM-0021 | PF-03814735 | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0107 | Recombinant Human TRIM68 293 Cell Lysate | Inquiry |
| EL-0109 | Recombinant Human TRIP4 Lysate | Inquiry |
| EL-0115 | Recombinant Human TRIM24 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| TRA2A | TRAF4 | TRAF5 | TRAF6 |
| TRAK2 | TRBP | TRDMT1 | TREX1 |
| TRF2 | TRIM11 | TRIM13 | TRIM16 |
| TRIM17 | TRIM2 | TRIM21 | trim24 |
| TRIM26 | TRIM28 | TRIM3 | TRIM33 More > |
| TRIM34 | TRIM35 | TRIM36 | TRIM37 |
| TRIM38 | TRIM39 | TRIM4 | TRIM5 |
| TRIM55 | TRIM6 | TRIM63 | TRIM66 |
| TRIM68 | TRIM8 | TRIM9 | TRIML1 |
| TRIP4 | Tristetraprolin | TRIT1 | TrkA |
| TRMT2A | TRMT44 | TRMT5 | TRMT6 |
| TROVE2 | TRUB2 | TRX1 | TRβ1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools