Recombinant Human RELA


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0858
Product Name:  Recombinant Human RELA
Product Overview:  Recombinant fragment corresponding to amino acids 432-505 of Human NFkB p65 with a N terminal proprietary tag; predicted MWt 33.77 kDa inclusive of tag
Description:  NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  33.770kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT
Sequence Similarities:  Contains 1 RHD (Rel-like) domain.
Expression System:  Wheat germ
Protein Length:  74 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ]
Gene ID NCBI:  5970
Official Symbol:  RELA
Synonyms:  RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65;
mRNA Refseq:  NM_001145138
Protein Refseq:  NP_001138610
MIM:  164014
UniProt ID:  Q04206
Chromosome Location:  11q13
Function:  DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding;
Product Types
◆ Extracts & Lysates
EL-0113 Recombinant Human RELA 293 Cell Lysate Inquiry
◆ Research Kits
EKIT-0275 HEK 293 RELA Nuclear Translocation Assay Kit Inquiry
◆ Cell Lines
CL-0396 Human RECQL4 Knockout Cell Line 5bp deletion Inquiry
◆ Proteins & Enzymes
PE-0856 Recombinant Human RELA, His-tagged Inquiry
PE-0857 Recombinant Human RELA Inquiry
Related Gene / Proteins
RECQL4 rela Reptin REST
REXO5

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.