| Cat.No.: | PE-0857 |
| Product Overview: | Recombinant fragment of Human NFkB p65 with a N terminal proprietary tag; 50.27 kDa inclusive of tag. |
| Description: | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 50.270kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEG RSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKD PPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC FQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN RNSGSCLGGDEIFLLCDKVQ |
| Sequence Similarities: | Contains 1 RHD (Rel-like) domain. |
| Expression System: | Wheat germ |
| Protein Length: | 220 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
| Gene ID NCBI: | 5970 |
| Official Symbol: | RELA |
| Synonyms: | RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65; |
| mRNA Refseq: | NM_001145138 |
| Protein Refseq: | NP_001138610 |
| MIM: | 164014 |
| UniProt ID: | Q04206 |
| Chromosome Location: | 11q13 |
| Function: | DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0113 | Recombinant Human RELA 293 Cell Lysate | Inquiry |
| ◆ Research Kits | ||
| EKIT-0275 | HEK 293 RELA Nuclear Translocation Assay Kit | Inquiry |
| ◆ Cell Lines | ||
| CL-0396 | Human RECQL4 Knockout Cell Line 5bp deletion | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0856 | Recombinant Human RELA, His-tagged | Inquiry |
| PE-0857 | Recombinant Human RELA | Inquiry |
| Related Gene / Proteins | |||
| RECQL4 | rela | Reptin | REST |
| REXO5 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools