Recombinant Human TAF7, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0835
Product Overview:  Recombinant full length protein, corresponding to amino acids 1-349 of Human TAF7 with N terminal His tag, 61.7kDa.
Description:  The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 76 μl aqua dest.
Tag:  His
Amino Acid Sequence:  MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLK DRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLK TIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDP KASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKK KYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAEN QGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSED EDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQE NEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMK VENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE K
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa [ Homo sapiens ]
Gene ID NCBI:  6879
Official Symbol:  TAF7
Synonyms:  TAF7; TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa; TAF2F, TATA box binding protein (TBP) associated factor, RNA polymerase II, F, 55kD; transcription initiation factor TFIID subunit 7; TAFII55;
mRNA Refseq:  NM_005642
Protein Refseq:  NP_005633
MIM:  600573
UniProt ID:  Q15545
Chromosome Location:  5q31
Function:  histone acetyltransferase binding; protein binding; contributes_to sequence-specific DNA binding transcription factor activity; thyroid hormone receptor binding; transcription coactivator activity;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart