Cat.No.: | PE-0802 |
Product Name: | Recombinant Human SUZ12 |
Product Overview: | Recombinant fragment corresponding to amino acids 640-739 of Human SUZ12 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa. |
Description: | This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. |
Tissue Specificity: | Overexpressed in breast and colon cancer. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 36.630kDa inclusive of tags |
Species: | Human |
Amino Acid Sequence: | VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL |
Sequence Similarities: | Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger. |
Expression System: | Wheat germ |
Protein Length: | 100 amino acids |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | SUZ12 suppressor of zeste 12 homolog (Drosophila) [ Homo sapiens ] |
Gene ID NCBI: | 23512 |
Official Symbol: | SUZ12 |
Synonyms: | SUZ12; suppressor of zeste 12 homolog (Drosophila); polycomb protein SUZ12; CHET9; JJAZ1; KIAA0160; |
mRNA Refseq: | NM_015355 |
Protein Refseq: | NP_056170 |
MIM: | 606245 |
UniProt ID: | Q15022 |
Chromosome Location: | 17q21 |
Function: | chromatin binding; histone methyltransferase activity; metal ion binding; methylated histone residue binding; protein binding; |
Product Types | ||
◆ Antibodies | ||
EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0100 | Chaetocin | Inquiry |
◆ Extracts & Lysates | ||
EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
SUDS3 | SUMO | SUMO1 | SUMO2 |
SUMO3 | SUN1 | Surf6 | suv39h1 |
SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
SUZ12 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools