Recombinant Human SUZ12

Inquiry

  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0802
Product Overview:  Recombinant fragment corresponding to amino acids 640-739 of Human SUZ12 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa.
Description:  This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region.
Tissue Specificity:  Overexpressed in breast and colon cancer.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36.630kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
Sequence Similarities:  Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger.
Expression System:  Wheat germ
Protein Length:  100 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SUZ12 suppressor of zeste 12 homolog (Drosophila) [ Homo sapiens ]
Gene ID NCBI:  23512
Official Symbol:  SUZ12
Synonyms:  SUZ12; suppressor of zeste 12 homolog (Drosophila); polycomb protein SUZ12; CHET9; JJAZ1; KIAA0160;
mRNA Refseq:  NM_015355
Protein Refseq:  NP_056170
MIM:  606245
UniProt ID:  Q15022
Chromosome Location:  17q21
Function:  chromatin binding; histone methyltransferase activity; metal ion binding; methylated histone residue binding; protein binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.