| Cat.No.: | PE-0725 |
| Product Name: | Recombinant Human SP2 |
| Product Overview: | Recombinant fragment of Human SP2 transcription factor with N terminal proprietary tag; Predicted MW 35.64 kDa. |
| Description: | This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 35.640kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT |
| Sequence Similarities: | Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | 91 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SP2 Sp2 transcription factor [ Homo sapiens ] |
| Gene ID NCBI: | 6668 |
| Official Symbol: | SP2 |
| Synonyms: | SP2; Sp2 transcription factor; transcription factor Sp2; KIAA0048; |
| mRNA Refseq: | NM_003110 |
| Protein Refseq: | NP_003101 |
| MIM: | 601801 |
| UniProt ID: | Q02086 |
| Chromosome Location: | 17q21.3-q22 |
| Function: | DNA binding; histone deacetylase binding; metal ion binding; zinc ion binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0089 | Recombinant Human SP2 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0161 | Human SP1 Knockout Cell Line 2bp deletion | Inquiry |
| CL-0169 | Human SP140L Knockout Cell Line | Inquiry |
| CL-0170 | Human SP100 Knockout Cell Line 20bp deletion | Inquiry |
| CL-0171 | Human SP110 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| SP1 | SP100 | SP110 | SP140 |
| SP140L | SP2 | SP3 | SP6 |
| SPDL1 | SPF30 | SPIN1 | SPOP |
| SPT16 | SPT3 | Spt6 | SPTY2D1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools