| Cat.No.: | PE-0687 |
| Product Overview: | Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa. |
| Description: | The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. |
| Tissue Specificity: | Up-regulated in adenocarcinomas of the stomach (at protein level). |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 148 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF |
| Sequence Similarities: | Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SP1 Sp1 transcription factor [ Homo sapiens ] |
| Gene ID NCBI: | 6667 |
| Official Symbol: | SP1 |
| Synonyms: | SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1; |
| mRNA Refseq: | NM_001251825 |
| Protein Refseq: | NP_001238754 |
| MIM: | 189906 |
| UniProt ID: | P08047 |
| Chromosome Location: | 12q13.1 |
| Function: | DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0089 | Recombinant Human SP2 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0161 | Human SP1 Knockout Cell Line 2bp deletion | Inquiry |
| CL-0169 | Human SP140L Knockout Cell Line | Inquiry |
| CL-0170 | Human SP100 Knockout Cell Line 20bp deletion | Inquiry |
| CL-0171 | Human SP110 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| SP1 | SP100 | SP110 | SP140 |
| SP140L | SP2 | SP3 | SP6 |
| SPDL1 | SPF30 | SPIN1 | SPOP |
| SPT16 | SPT3 | Spt6 | SPTY2D1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.