Recombinant Human SP1, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0687
Product Name:  Recombinant Human SP1, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa.
Description:  The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene.
Tissue Specificity:  Up-regulated in adenocarcinomas of the stomach (at protein level).
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 148 μl aqua dest.
Tag:  His
Amino Acid Sequence:  GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF
Sequence Similarities:  Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SP1 Sp1 transcription factor [ Homo sapiens ]
Gene ID NCBI:  6667
Official Symbol:  SP1
Synonyms:  SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1;
mRNA Refseq:  NM_001251825
Protein Refseq:  NP_001238754
MIM:  189906
UniProt ID:  P08047
Chromosome Location:  12q13.1
Function:  DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.