Cat.No.: | PE-0673 |
Product Name: | Recombinant Human BRMS1L Protein, GST-tagged |
Product Overview: | Human BRMS1L full-length ORF ( NP_115728.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
Description: | The protein encoded by this gene shows sequence similarity to the human breast carcinoma metastasis suppressor (BRMS1) protein and the mammalian Sds3 (suppressor of defective silencing 3) proteins. This protein is a component of the mSin3a family of histone deacetylase complexes (HDAC). |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Molecular Weight: | 64 kDa |
Species: | Human |
Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Tag: | GST |
Amino Acid Sequence: | MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS |
Expression System: | Wheat Germ |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | BRMS1L breast cancer metastasis-suppressor 1-like [ Homo sapiens ] |
Gene ID NCBI: | 84312 |
Official Symbol: | BRMS1L |
Synonyms: | BRMS1L; breast cancer metastasis-suppressor 1-like; breast cancer metastasis suppressor 1 , BRMS1; breast cancer metastasis-suppressor 1-like protein; FLJ39177; MGC11296; BRMS1-like protein p40; BRMS1-homolog protein p40; BRMS1; |
mRNA Refseq: | NM_032352 |
Protein Refseq: | NP_115728 |
UniProt ID: | Q5PSV4 |
Product Types | ||
◆ Synthetic Peptides | ||
SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
SP-0004 | Bromodomain Ligand 3 | Inquiry |
SP-0006 | Bromodomain Ligand 4 | Inquiry |
Related Gene / Proteins | |||
BRCA1 | BRCA2 | BRCC3 | BRD |
brd1 | brd2 | brd3 | brd4 |
BRD7 | BRD8 | brd9 | brdt |
BRL | BRM | BRMS1 | BRPF1 |
BRPF2 | brpf3 | BRWD1 | BRWD3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools