| Cat.No.: | PE-0560 |
| Product Overview: | Recombinant fragment corresponding to amino acids 406-508 of Human Serum Response Factor SRF with an N terminal proprietary tag; Predicted MWt 36.96 kDa. |
| Description: | This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.960kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSH SQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQA GSSSNLTELQVVNLDTAHSTKSE |
| Sequence Similarities: | Contains 1 MADS-box domain. |
| Expression System: | Wheat germ |
| Protein Length: | 103 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SRF serum response factor (c-fos serum response element-binding transcription factor) [ Homo sapiens ] |
| Gene ID NCBI: | 6722 |
| Official Symbol: | SRF |
| Synonyms: | SRF; serum response factor (c-fos serum response element-binding transcription factor); serum response factor; MCM1; |
| mRNA Refseq: | NM_003131 |
| Protein Refseq: | NP_003122 |
| MIM: | 600589 |
| UniProt ID: | P11831 |
| Chromosome Location: | 6p |
| Function: | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; contributes_to RNA polymerase II core promoter sequence-specific DNA binding transcription factor |
| Product Types | ||
| ◆ Research Kits | ||
| EKIT-0422 | SREBP-2 Transcription Factor Assay Kit | Inquiry |
| EKIT-0426 | SREBP-1 Transcription Factor Assay Kit | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0560 | Recombinant Human SRF | Inquiry |
| PE-0561 | Recombinant Human SRF, His-tagged | Inquiry |
| PE-0562 | Recombinant Human SRF, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| SRBD1 | SRC1 | SREBP | SREBP-1 |
| SREBP-2 | SRF | SRP14 | SRP19 |
| SRY | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools