Recombinant Human SRF


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0560
Product Name:  Recombinant Human SRF
Product Overview:  Recombinant fragment corresponding to amino acids 406-508 of Human Serum Response Factor SRF with an N terminal proprietary tag; Predicted MWt 36.96 kDa.
Description:  This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs).
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36.960kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSH SQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQA GSSSNLTELQVVNLDTAHSTKSE
Sequence Similarities:  Contains 1 MADS-box domain.
Expression System:  Wheat germ
Protein Length:  103 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SRF serum response factor (c-fos serum response element-binding transcription factor) [ Homo sapiens ]
Gene ID NCBI:  6722
Official Symbol:  SRF
Synonyms:  SRF; serum response factor (c-fos serum response element-binding transcription factor); serum response factor; MCM1;
mRNA Refseq:  NM_003131
Protein Refseq:  NP_003122
MIM:  600589
UniProt ID:  P11831
Chromosome Location:  6p
Function:  RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; contributes_to RNA polymerase II core promoter sequence-specific DNA binding transcription factor

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.