Recombinant Human H2AFZ

Inquiry

  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0552
Product Overview:  Recombinant full length protein of Human H2A.Z with proprietary tag; predicted MW 40.19 kDa, inclusive of tag.
Description:  Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  40.190kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSR TTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK RITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV
Sequence Similarities:  Belongs to the histone H2A family.
Expression System:  Wheat germ
Protein Length:  128 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  H2AFZ H2A histone family, member Z [ Homo sapiens ]
Gene ID NCBI:  3015
Official Symbol:  H2AFZ
Synonyms:  H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z;
mRNA Refseq:  NM_002106
Protein Refseq:  NP_002097
MIM:  142763
UniProt ID:  P0C0S5
Chromosome Location:  4q23
Function:  DNA binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.