Cat.No.: | PE-0552 |
Product Name: | Recombinant Human H2AFZ |
Product Overview: | Recombinant full length protein of Human H2A.Z with proprietary tag; predicted MW 40.19 kDa, inclusive of tag. |
Description: | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 40.190kDa inclusive of tags |
Species: | Human |
Amino Acid Sequence: | MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSR TTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK RITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV |
Sequence Similarities: | Belongs to the histone H2A family. |
Expression System: | Wheat germ |
Protein Length: | 128 amino acids |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | H2AFZ H2A histone family, member Z [ Homo sapiens ] |
Gene ID NCBI: | 3015 |
Official Symbol: | H2AFZ |
Synonyms: | H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z; |
mRNA Refseq: | NM_002106 |
Protein Refseq: | NP_002097 |
MIM: | 142763 |
UniProt ID: | P0C0S5 |
Chromosome Location: | 4q23 |
Function: | DNA binding; |
Product Types | ||
◆ Nucleosomes | ||
NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
◆ Synthetic Peptides | ||
SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
SP-0010 | Histone H4 peptide (1-21) | Inquiry |
SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
Related Gene / Proteins | |||
HIC1 | HIF1A | HIF1AN | HINFP |
HIPK1 | HIPK2 | HIRA | Histone |
Histone H1 | Histone H2A | Histone H2B | Histone H3 |
Histone H4 | HIV-1 reverse transcriptase |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools