| Cat.No.: | PE-0535 |
| Product Name: | Recombinant Human HES1 |
| Product Overview: | Recombinant fragment corresponding to amino acids 36-142 of Human Hes1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa inclusive of tag. |
| Description: | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37.400kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKL EKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFS ECMNEVTRFLSTCEGVNTEVRTRLLGH |
| Sequence Similarities: | Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain. |
| Expression System: | Wheat germ |
| Protein Length: | 107 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ] |
| Gene ID NCBI: | 3280 |
| Official Symbol: | HES1 |
| Synonyms: | HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; |
| mRNA Refseq: | NM_005524 |
| Protein Refseq: | NP_005515 |
| MIM: | 139605 |
| UniProt ID: | Q14469 |
| Chromosome Location: | 3q28-q29 |
| Function: | DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0061 | Recombinant Human HES1 293 Cell Lysate | Inquiry |
| EL-0112 | Recombinant Human HEY2 293 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0078 | Human HELLS Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Antibodies | ||
| EAb-0363 | HELLS Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0534 | Recombinant Human HES1 | Inquiry |
| Related Gene / Proteins | |||
| HELLS | HELZ | HEMK1 | HERC3 |
| HERC6 | HES1 | HEY2 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
