Recombinant Human HES1


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0534
Product Name:  Recombinant Human HES1
Product Overview:  Recombinant fragment corresponding to amino acids 201-280 of Human Hes1 with a proprietary tag; Predicted MWt 34.91 kDa.
Description:  This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
Applications:  Useful for Antibody Production and Protein Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  34.910kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Sequence Similarities:  Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain.
Expression System:  Wheat germ
Protein Length:  80 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ]
Gene ID NCBI:  3280
Official Symbol:  HES1
Synonyms:  HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1;
mRNA Refseq:  NM_005524
Protein Refseq:  NP_005515
MIM:  139605
UniProt ID:  Q14469
Chromosome Location:  3q28-q29
Function:  DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding;
Product Types
◆ Extracts & Lysates
EL-0061 Recombinant Human HES1 293 Cell Lysate Inquiry
EL-0112 Recombinant Human HEY2 293 Cell Lysate Inquiry
◆ Cell Lines
CL-0078 Human HELLS Knockout Cell Line 1bp insertion Inquiry
◆ Antibodies
EAb-0363 HELLS Polyclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-0534 Recombinant Human HES1 Inquiry
Related Gene / Proteins
HELLS HELZ HEMK1 HERC3
HERC6 HES1 HEY2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.