Cat.No.: | PE-0534 |
Product Name: | Recombinant Human HES1 |
Product Overview: | Recombinant fragment corresponding to amino acids 201-280 of Human Hes1 with a proprietary tag; Predicted MWt 34.91 kDa. |
Description: | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. |
Applications: | Useful for Antibody Production and Protein Array |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 34.910kDa inclusive of tags |
Species: | Human |
Amino Acid Sequence: | APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN |
Sequence Similarities: | Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain. |
Expression System: | Wheat germ |
Protein Length: | 80 amino acids |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ] |
Gene ID NCBI: | 3280 |
Official Symbol: | HES1 |
Synonyms: | HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; |
mRNA Refseq: | NM_005524 |
Protein Refseq: | NP_005515 |
MIM: | 139605 |
UniProt ID: | Q14469 |
Chromosome Location: | 3q28-q29 |
Function: | DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding; |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0061 | Recombinant Human HES1 293 Cell Lysate | Inquiry |
EL-0112 | Recombinant Human HEY2 293 Cell Lysate | Inquiry |
◆ Cell Lines | ||
CL-0078 | Human HELLS Knockout Cell Line 1bp insertion | Inquiry |
◆ Antibodies | ||
EAb-0363 | HELLS Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-0534 | Recombinant Human HES1 | Inquiry |
Related Gene / Proteins | |||
HELLS | HELZ | HEMK1 | HERC3 |
HERC6 | HES1 | HEY2 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools