Recombinant Human SMARCA4, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0462
Product Name:  Recombinant Human SMARCA4, GST-tagged
Product Overview:  Recombinant Human SMARCA4(a.a. 1480-1603), fused with N-terminal GST-tag, was expressed in an E. coli expression system.
Description:  The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene.
Applications:  Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  41.3 kDa
Purity:  >96%
Species:  Human
Formulation:  40 mM Tris-HCl, pH 8.0,110 mM NaCl, 2.2 mM KCl, and 20% glycerol.
Tag:  GST
Amino Acid Sequence:  MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRY IADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHV THPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLE VLFQGPLGSAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSE
Expression System:  E. coli
Protein Length:  1480-1603
Concentrations:  2.88 mg/ml
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SMARCA4 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [ Homo sapiens (human) ]
Gene ID NCBI:  6597
Synonyms:  SMARCA4; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4; SNF2L4; transcription activator BRG1; ATP dependent helicase SMARCA4; BAF190; brahma protein like 1; BRG1; BRM/SWI2 related gene 1; FLJ39786; global transcription activator homologous sequence; homeotic gene regulator; hSNF2b; mitotic growth and transcription activator; nuclear protein GRB1; SNF2; SNF2 BETA; SNF2 like 4; SNF2LB; sucrose nonfermenting like 4; SWI2; BAF190A; SNF2-like 4; protein BRG-1; brahma protein-like 1; BRM/SWI2-related gene 1; protein brahma homolog 1; BRG1-associated factor 190A; sucrose nonfermenting-like 4; ATP-dependent helicase SMARCA4; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4; RTPS2; SNF2-BETA
mRNA Refseq:  NM_001128849
Protein Refseq:  NP_001122321
MIM:  603254
Chromosome Location:  19p13.2
Function:  ATP binding; DNA-dependent ATPase activity; contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.