| Cat.No.: | PE-0439 |
| Product Overview: | Recombinant Human MTA2(521 a.a. - 620 a.a.) fused with GSTtag at N-terminal was expressed in Wheat Germ. |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 36.74 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | VKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKAL |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | MTA2 metastasis associated 1 family, member 2 [ Homo sapiens ] |
| Gene ID NCBI: | 9219 |
| Official Symbol: | MTA2 |
| Synonyms: | MTA2; metastasis associated 1 family, member 2; metastasis associated gene family, member 2 , MTA1L1; metastasis-associated protein MTA2; MTA1 L1; MTA1-L1 protein; metastasis-associated 1-like 1; metastasis-associated protein 2; metastasis -associated gene 1-like 1; p53 target protein in deacetylase complex; metastasis associated gene family, member 2; PID; MTA1L1; DKFZp686F2281; |
| mRNA Refseq: | NM_004739 |
| Protein Refseq: | NP_004730 |
| MIM: | 603947 |
| UniProt ID: | O94776 |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
| EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0325 | MTF2 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0435 | Recombinant Human MTA2, GST-tagged | Inquiry |
| Related Gene / Proteins | |||
| MTA | MTA1 | MTA2 | MTA3 |
| MTF1 | MTF2 | MTR | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.