Recombinant Human UHRF1


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0416
Product Name:  Recombinant Human UHRF1
Product Overview:  Recombinant fragment corresponding to aa 694-793 of human UHRF1 with a proprietary tag; 36.63kDa inclusive of tag.
Description:  This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.
Applications:  This product is useful for Antibody Production and Protein Array
Tissue Specificity:  Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36.630kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Sequence Similarities:  Contains 1 PHD-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.Contains 1 YDG domain.
Expression System:  Wheat germ
Protein Length:  100 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  UHRF1 ubiquitin-like with PHD and ring finger domains 1 [ Homo sapiens ]
Gene ID NCBI:  29128
Official Symbol:  UHRF1
Synonyms:  UHRF1; ubiquitin-like with PHD and ring finger domains 1; E3 ubiquitin-protein ligase UHRF1; FLJ21925; ICBP90; Np95; RNF106;
mRNA Refseq:  NM_001048201
Protein Refseq:  NP_001041666
MIM:  607990
UniProt ID:  Q96T88
Chromosome Location:  19p13.3
Function:  DNA binding; core promoter proximal region sequence-specific DNA binding; ligase activity; metal ion binding; methyl-CpG binding;
Product Types
◆ Antibodies
EAb-0011 UHRF2 Polyclonal Antibody Inquiry
EAb-0012 UHRF1 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0044 Recombinant Human UHRF1 293 Cell Lysate Inquiry
◆ Proteins & Enzymes
PE-0416 Recombinant Human UHRF1 Inquiry
PE-0417 Recombinant Zebrafish UHRF1 Inquiry
Related Gene / Proteins
UHRF1 UHRF2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.