| Cat.No.: | PE-0403 |
| Product Name: | Recombinant Human MECP2 |
| Product Overview: | Recombinant fragment corresponding to amino acids 81-170 of Human MeCP2 with a proprietary tag; Predicted MWt 35.53 kDa including tag. |
| Description: | DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. |
| Tissue Specificity: | Present in all adult somatic tissues tested. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 35.530kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ |
| Sequence Similarities: | Contains 2 A.T hook DNA-binding domains.Contains 1 MBD (methyl-CpG-binding) domain. |
| Expression System: | Wheat germ |
| Protein Length: | 90 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ] |
| Gene ID NCBI: | 4204 |
| Official Symbol: | MECP2 |
| Synonyms: | MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2; |
| mRNA Refseq: | NM_001110792 |
| Protein Refseq: | NP_001104262 |
| MIM: | 300005 |
| UniProt ID: | P51608 |
| Chromosome Location: | Xq28 |
| Function: | DNA binding; double-stranded methylated DNA binding; protein N-terminus binding; protein binding; protein domain specific binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0043 | Recombinant Human MECP2 293 Cell Lysate | Inquiry |
| EL-0111 | Recombinant Human MEF2B Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0067 | MeCP2 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0109 | Human MECP2 Knockout Cell Line 1bp insertion | Inquiry |
| CL-0110 | Human MEN1 Knockout Cell Line 1bp insertion | Inquiry |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools