Recombinant Human H2AFY protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0400
Product Overview:  Recombinant human H2AFY gene (derived from BC095406) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.
Applications:  1. May be used as specific substrate protein for kinase enzymatic assay.2. May be used for in vitro histone/DNA reconstitution assay.3. May be used as native immunogen for specific antibody production.4. May be used as protein biomarker for Huntinton disease monitoring.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE
Species:  Human
Formulation:  1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPV YMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKG KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKL NLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKF VIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIK TVYFVLFDSESIGIYVQEMAKLDAN
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  H2AFY H2A histone family, member Y [ Homo sapiens ]
Gene ID NCBI:  9555
Official Symbol:  H2AFY
Synonyms:  H2AFY; H2A histone family, member Y; core histone macro-H2A.1; macroH2A1.2; histone H2A.y
mRNA Refseq:  NM_001040158
Protein Refseq:  NP_001035248
MIM:  610054
UniProt ID:  O75367
Chromosome Location:  5q31.1
Function:  DNA binding; chromatin binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart