| Cat.No.: | PE-0400 |
| Product Name: | Recombinant Human H2AFY protein, T7/His-tagged |
| Product Overview: | Recombinant human H2AFY gene (derived from BC095406) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli. |
| Applications: | 1. May be used as specific substrate protein for kinase enzymatic assay.2. May be used for in vitro histone/DNA reconstitution assay.3. May be used as native immunogen for specific antibody production.4. May be used as protein biomarker for Huntinton disease monitoring. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE |
| Species: | Human |
| Formulation: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPV YMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKG KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKL NLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKF VIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIK TVYFVLFDSESIGIYVQEMAKLDAN |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | H2AFY H2A histone family, member Y [ Homo sapiens ] |
| Gene ID NCBI: | 9555 |
| Official Symbol: | H2AFY |
| Synonyms: | H2AFY; H2A histone family, member Y; core histone macro-H2A.1; macroH2A1.2; histone H2A.y |
| mRNA Refseq: | NM_001040158 |
| Protein Refseq: | NP_001035248 |
| MIM: | 610054 |
| UniProt ID: | O75367 |
| Chromosome Location: | 5q31.1 |
| Function: | DNA binding; chromatin binding; |
| Product Types | ||
| ◆ Nucleosomes | ||
| NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
| NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
| SP-0010 | Histone H4 peptide (1-21) | Inquiry |
| SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
| Related Gene / Proteins | |||
| HIC1 | HIF1A | HIF1AN | HINFP |
| HIPK1 | HIPK2 | HIRA | Histone |
| Histone H1 | Histone H2A | Histone H2B | Histone H3 |
| Histone H4 | HIV-1 reverse transcriptase | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
