Cat.No.: | PE-0400 |
Product Name: | Recombinant Human H2AFY protein, T7/His-tagged |
Product Overview: | Recombinant human H2AFY gene (derived from BC095406) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli. |
Applications: | 1. May be used as specific substrate protein for kinase enzymatic assay.2. May be used for in vitro histone/DNA reconstitution assay.3. May be used as native immunogen for specific antibody production.4. May be used as protein biomarker for Huntinton disease monitoring. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Purity: | >90% by SDS-PAGE |
Species: | Human |
Formulation: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Tag: | T7/His |
Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPV YMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKG KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKL NLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKF VIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIK TVYFVLFDSESIGIYVQEMAKLDAN |
Expression System: | E. coli |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | H2AFY H2A histone family, member Y [ Homo sapiens ] |
Gene ID NCBI: | 9555 |
Official Symbol: | H2AFY |
Synonyms: | H2AFY; H2A histone family, member Y; core histone macro-H2A.1; macroH2A1.2; histone H2A.y |
mRNA Refseq: | NM_001040158 |
Protein Refseq: | NP_001035248 |
MIM: | 610054 |
UniProt ID: | O75367 |
Chromosome Location: | 5q31.1 |
Function: | DNA binding; chromatin binding; |
Product Types | ||
◆ Nucleosomes | ||
NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
◆ Synthetic Peptides | ||
SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
SP-0010 | Histone H4 peptide (1-21) | Inquiry |
SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
Related Gene / Proteins | |||
HIC1 | HIF1A | HIF1AN | HINFP |
HIPK1 | HIPK2 | HIRA | Histone |
Histone H1 | Histone H2A | Histone H2B | Histone H3 |
Histone H4 | HIV-1 reverse transcriptase |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools