Recombinant Human CREBBP protein, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0385
Product Name:  Recombinant Human CREBBP protein, His-tagged
Product Overview:  Recombinant Human CREBBP(a.a: 1081-1197) fused with His tag at N-terminal was expressed in E. coli.
Applications:  Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  14.9 kDa
Purity:  > 98%
Species:  Human
Formulation:  45 mM Tris-HCl, pH 8.0, 124 mM NaCl, 2.4 mM KCl, and 10% glycerol
Tag:  His
Amino Acid Sequence:  MHHHHHHRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQY QEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Expression System:  E. coli
Concentrations:  1.26 mg/ml
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  CREBBP CREB binding protein [ Homo sapiens ]
Gene ID NCBI:  1387
Official Symbol:  CREBBP
Synonyms:  CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS;
mRNA Refseq:  NM_004380
Protein Refseq:  NP_004371
MIM:  600140
UniProt ID:  Q92793
Chromosome Location:  16p13.3
Product Types
◆ Cell Lines
CL-0055 Human CREBBP Knockout Cell Line 1bp insertion Inquiry
◆ Bioactive Small Molecules
BSM-0094 C646 Inquiry
BSM-0124 EML-425 Inquiry
BSM-0150 I-CBP112 (Hydrochloride) Inquiry
◆ Research Kits
EKIT-0122 CBP bromodomain TR-FRET Assay Kit Inquiry
Related Gene / Proteins
CREB CREB3 crebbp CRISP1
CRISP3 CRP

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.