Recombinant Human BRPF1 Protein, GST-tagged

Inquiry

  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0374
Product Overview:  Human BRPF1 partial ORF ( NP_001003694, 500 a.a. - 590 a.a.) recombinant protein with GST-tag at N-terminal.
Description:  The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  35.75 kDa
Species:  Human
Formulation:  50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Tag:  GST
Amino Acid Sequence:  ILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKS
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  BRPF1 bromodomain and PHD finger containing, 1 [ Homo sapiens ]
Gene ID NCBI:  7862
Official Symbol:  BRPF1
Synonyms:  BR140
mRNA Refseq:  NM_001003694
Protein Refseq:  NP_001003694.1
MIM:  602410
UniProt ID:  P55201

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.