| Cat.No.: | PE-0357 |
| Product Overview: | Human BRD8 partial ORF ( NP_631938, 33 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 36.3 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | BRD8 bromodomain containing 8 [ Homo sapiens ] |
| Gene ID NCBI: | 10902 |
| Official Symbol: | BRD8 |
| Synonyms: | BRD8; bromodomain containing 8; bromodomain-containing protein 8; p120; SMAP; trCP120; skeletal muscle abundant protein 2; thyroid hormone receptor coactivating protein of 120 kDa; SMAP2; |
| mRNA Refseq: | NM_001164326 |
| Protein Refseq: | NP_001157798 |
| MIM: | 602848 |
| UniProt ID: | Q9H0E9 |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
| SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
| SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
| SP-0004 | Bromodomain Ligand 3 | Inquiry |
| SP-0006 | Bromodomain Ligand 4 | Inquiry |
| Related Gene / Proteins | |||
| BRCA1 | BRCA2 | BRCC3 | BRD |
| brd1 | brd2 | brd3 | brd4 |
| BRD7 | BRD8 | brd9 | brdt |
| BRL | BRM | BRMS1 | BRPF1 |
| BRPF2 | brpf3 | BRWD1 | BRWD3 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools