Recombinant Human BRD8 Protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0357
Product Name:  Recombinant Human BRD8 Protein, GST-tagged
Product Overview:  Human BRD8 partial ORF ( NP_631938, 33 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
Description:  The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  36.3 kDa
Species:  Human
Formulation:  50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Tag:  GST
Amino Acid Sequence:  RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  BRD8 bromodomain containing 8 [ Homo sapiens ]
Gene ID NCBI:  10902
Official Symbol:  BRD8
Synonyms:  BRD8; bromodomain containing 8; bromodomain-containing protein 8; p120; SMAP; trCP120; skeletal muscle abundant protein 2; thyroid hormone receptor coactivating protein of 120 kDa; SMAP2;
mRNA Refseq:  NM_001164326
Protein Refseq:  NP_001157798
MIM:  602848
UniProt ID:  Q9H0E9

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.